PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang0349s00210.1
Common NameLR48_Vigan01g114200
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family VOZ
Protein Properties Length: 523aa    MW: 57803.8 Da    PI: 5.6226
Description VOZ family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang0349s00210.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1VOZ446.53.1e-1372464621217
               VOZ   1 pppsaflgpkcalwdctrpaqgsewlqdycssfhatlalneglpgttpvlrpkgidlkdgllfaalsakvqgkevgipecegaatakspwnaa 93 
                       pppsaflgpkcalwdc+rpaqg +w+qdycssfha+lalneg+pg++pvlrp+gi+lkd+llfaalsak+qgk+vgipecegaatakspwna+
  Vang0349s00210.1 246 PPPSAFLGPKCALWDCPRPAQGLDWCQDYCSSFHAALALNEGPPGMAPVLRPGGIGLKDNLLFAALSAKAQGKDVGIPECEGAATAKSPWNAP 338
                       89******************************************************************************************* PP

               VOZ  94 elfdlsllegetirewlffdkprrafesgnrkqrslpdysgrgwhesrkqvmkefgglkrsyymdpqpsssfewhlyeyeineldalalyrle 186
                       elfdls+legetirewlffdkprrafesgnrkqrslpdysgrgwhesrkqvm+efgglkrsyymdpqp+++fewhlyeyei+++da+alyrle
  Vang0349s00210.1 339 ELFDLSVLEGETIREWLFFDKPRRAFESGNRKQRSLPDYSGRGWHESRKQVMNEFGGLKRSYYMDPQPLNHFEWHLYEYEISKCDACALYRLE 431
                       ********************************************************************************************* PP

               VOZ 187 lklvdekksakgkvskdsladlqkklgrlta 217
                       lklvd+kk++k+k+++ds+adlqk++grl+a
  Vang0349s00210.1 432 LKLVDGKKNSKTKLASDSVADLQKQMGRLSA 462
                       *****************************97 PP

Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009408Biological Processresponse to heat
GO:0009414Biological Processresponse to water deprivation
GO:0009631Biological Processcold acclimation
GO:0009816Biological Processdefense response to bacterium, incompatible interaction
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048578Biological Processpositive regulation of long-day photoperiodism, flowering
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 523 aa     Download sequence    Send to blast
LAMKKVPKNS CKSASHRLFK DKAKNRVDDL QVMFLDLQFA RKESRTVDAA VLEEQVHQML  60
REWKAELNEP SPASSLQQGG SLGSFSTDIC RLLQLCDEED DASSPLAAPK PEPNDQTLQA  120
RGKVGFQEMD QLNTANLQSG LGGPEGYYSD RDPLVVGFDL STVARMMGLG EGQQQHDFPL  180
IDECKNSTSS VQNAAANNPD GHALEYHQFD LHQDYDHGFY TGFNGTGYCE EDAIPHISSY  240
LPSICPPPSA FLGPKCALWD CPRPAQGLDW CQDYCSSFHA ALALNEGPPG MAPVLRPGGI  300
GLKDNLLFAA LSAKAQGKDV GIPECEGAAT AKSPWNAPEL FDLSVLEGET IREWLFFDKP  360
RRAFESGNRK QRSLPDYSGR GWHESRKQVM NEFGGLKRSY YMDPQPLNHF EWHLYEYEIS  420
KCDACALYRL ELKLVDGKKN SKTKLASDSV ADLQKQMGRL SAEFPHDNKR AAKGRTKVNS  480
KVGIGGVYSA SHRVTTLNGA YEYGLAAPYD YLVENMGDYY GT*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150340.0AP015034.1 Vigna angularis var. angularis DNA, chromosome 1, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014509818.10.0PREDICTED: transcription factor VOZ1-like
SwissprotQ9SGQ00.0VOZ1_ARATH; Transcription factor VOZ1
TrEMBLA0A0L9TMC50.0A0A0L9TMC5_PHAAN; Uncharacterized protein
STRINGGLYMA07G32374.10.0(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28520.20.0vascular plant one zinc finger protein
Publications ? help Back to Top
  1. Yang K, et al.
    Genome sequencing of adzuki bean (Vigna angularis) provides insight into high starch and low fat accumulation and domestication.
    Proc. Natl. Acad. Sci. U.S.A., 2015. 112(43): p. 13213-8
    [PMID:26460024]